PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG269000.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 313aa    MW: 34530.7 Da    PI: 7.6446
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG269000.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC69.25.4e-2271114245
                  WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                           epgrCrRtDGKkWRCsr++++++k+CErH++r+++rsrk++e+
  Pavir.8KG269000.3.p  71 VEPGRCRRTDGKKWRCSRDAIGDQKYCERHIKRNCHRSRKHVES 114
                          59***************************************996 PP

2QLQ57.44.5e-201046137
                  QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                         ++FT++Q+++L++Q+l+yK++a n+PvP+ Ll++i++
  Pavir.8KG269000.3.p 10 GPFTPTQWMELEHQALIYKHFAVNAPVPSSLLLPIKR 46
                         59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.8E-121046IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.8E-141144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.3081146IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.89370114IPR014977WRC domain
PfamPF088792.3E-1772113IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MQGVLSRVRG PFTPTQWMEL EHQALIYKHF AVNAPVPSSL LLPIKRSINP WSGLGSSSLG  60
WTVFPPGSGD VEPGRCRRTD GKKWRCSRDA IGDQKYCERH IKRNCHRSRK HVESRKATPT  120
IAEPSLAVSG GPSLPSYAVP WQQQVKSSAA NVTDPFSRES NRKLLEKQNV HSQLSVSTPM  180
DSFNFSTSGS SQNRDIVALS PVEFQHDHDQ AYLVHGVGSS AENDNELQES LLLVSKETLD  240
DGPLGEVFKS KSCQSAYADI LTDQWTATRD MHSPTGILQL SNSNTMPLEN HINSNDYLMA  300
TMVNAQTVPT FL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.79300.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979454.10.0PREDICTED: growth-regulating factor 8-like
SwissprotQ6AWY11e-143GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLK3ZJC70.0K3ZJC7_SETIT; Uncharacterized protein
STRINGSi026680m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-42growth-regulating factor 2